PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 65512
Common NameRR5-1, SELMODRAFT_440049
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family ARR-B
Protein Properties Length: 246aa    MW: 27823.2 Da    PI: 7.8236
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
65512genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.62.4e-27186239155
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              k+r++W+ +LH++Fv+a++++ G+ekA+Pk+ile+m+++gLt+e+v+SHLQkYRl
    65512 186 KARVVWSFDLHQQFVKAINHI-GIEKAVPKRILEVMNIQGLTRENVASHLQKYRL 239
              68*******************.********************************8 PP

2Response_reg86.86.1e-2961141109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p  + ll+++l++ +y  v++++ +++al++l+e++  +D+++ D+ mp+mdG++ll+ i  e   +p+i+++a+ge + + + + +Ga 
         65512   6 VLVVDDDPCCLTLLERMLRECKY-AVTTCSRATAALTILRERKesFDVVISDVHMPDMDGFKLLELIGLEM-GIPVIMMSASGETDAVMKGVVYGAC 100
                   89*********************.***************888888**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l+Kp+ +eel++
         65512 101 DYLVKPVRIEELRN 114
                   ************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.3E-1311246IPR017053Response regulator B-type, plant
SuperFamilySSF521721.85E-372135IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.5E-423138No hitNo description
SMARTSM004486.9E-314116IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.1245120IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-256115IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.03E-277119No hitNo description
Gene3DG3DSA:1.10.10.607.8E-28184244IPR009057Homeodomain-like
SuperFamilySSF466895.91E-18184243IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-24186239IPR006447Myb domain, plants
PfamPF002491.3E-5188238IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
PTGLKVLVVD DDPCCLTLLE RMLRECKYAV TTCSRATAAL TILRERKESF DVVISDVHMP  60
DMDGFKLLEL IGLEMGIPVI MMSASGETDA VMKGVVYGAC DYLVKPVRIE ELRNIWQHVV  120
RRRTKDSAVR DEAPEEWEDF MRSTPTDSSE EADVDLRLLR KKKRPSCDFG GGGGDESVRS  180
IASNKKARVV WSFDLHQQFV KAINHIGIEK AVPKRILEVM NIQGLTRENV ASHLQKYRLY  240
LKRLSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-21183245264ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158164LRKKKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002967848.10.0type B response regulator
SwissprotA2XE317e-97ORR21_ORYSI; Two-component response regulator ORR21
SwissprotQ8H7S76e-97ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLD8R9R20.0D8R9R2_SELML; Type B response regulator
STRINGEFJ311950.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-92response regulator 2
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]